PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00005.1.g03420.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 237aa    MW: 24069.6 Da    PI: 9.7604
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00005.1.g03420.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.82.3e-384399460
                        zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                                  + l+cprCdst+tkfCyynny+l qPr+fCk+CrryWt+GGalrnvPvGgg+rk  +
  Zjn_sc00005.1.g03420.1.sm.mk 43 AGLPCPRCDSTDTKFCYYNNYNLGQPRHFCKGCRRYWTRGGALRNVPVGGGTRKATA 99
                                  6789**************************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.0E-324598IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9564599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-214793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MVHRSAGAAA AMQAGHQAAE GNALALVAAA AAAAGGGGPK EPAGLPCPRC DSTDTKFCYY  60
NNYNLGQPRH FCKGCRRYWT RGGALRNVPV GGGTRKATAA AARRKRASSS SASTASATAL  120
LVSSSPVPLS VSAPAYATTV LPYDLPSFMP ALGTSPLAAV EPDRRLLDLG GSFTSLLAPA  180
PDVRFSAGFL VGGLPPVMPP PASSAPALLL PPPHPPVSQA LAPEGFIWSM GWPDLSI
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0619504e-57BT061950.2 Zea mays full-length cDNA clone ZM_BFb0200H06 mRNA, complete cds.
GenBankKJ7270134e-57KJ727013.1 Zea mays clone pUT3994 C2C2-DOF transcription factor (DOF7) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457194.11e-61hypothetical protein SORBIDRAFT_03g003050
TrEMBLC5XLX91e-61C5XLX9_SORBI; Dof-type zinc finger protein 27
STRINGSb03g003050.14e-61(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.18e-28Dof family protein